DPCstruct | MC5048
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 107 ± 14 aa |
| Standard deviation of domain lengths | 13.91 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6SKI1 | 9-123 | ITVVAKEAPITVKRIPATHINEAIDNPGVARADVAVSIEKPLGDQEWASKVREYTPLQQHVLFWDRDGDGMIFPWDTYIGFRELGFN… |
| A0A1D6JA97 | 82-180 | SQTIVALQSPVTVMRPVRGDLEEHLPKPYLARALVAPDIYHPDGTAADEHGHHHMSVLQQHVAFFDRDDNGIIYPWETYSGMRVQVH… |
| A0A061EME7 | 7-114 | None |
| A0A0D9VRD1 | 531-644 | None |
| A0A1J8QFJ8 | 892-1014 | None |
| A0A7R7WHN6 | 23-143 | None |
| A0A371FSK0 | 3-79 | None |
| K4ACH7 | 169-286 | None |
| A0A5K1JVE4 | 35-106 | None |
| A0A804LGA7 | 43-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.