DPCstruct | MC50475
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 97 ± 13 aa |
| Standard deviation of domain lengths | 13.30 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E0NCD9 | 2-87 | VCLFGAIVHLLDIPLIIEKVRTPFPDCIARRTDTNEEVRIEFELYSSHFKKHRHDINQCDLLVCWQDDLGKWPNGFVLELHDLVKE |
| A0A2M8DL85 | 18-124 | VGEPINFRGIIYAPVNEQGVIFLFSKVHDDLGIKIEGIQQAYPDARGRRFNGRGWVEERIEFEYKASDFQTHGHDIEKCDIIVCWIN… |
| A0A7C1NSJ9 | 121-235 | None |
| A0A7X4FJY8 | 323-420 | None |
| A0A537HJK1 | 169-270 | None |
| A0A662TD09 | 23-118 | None |
| A0A1F3Y1A5 | 6-89 | None |
| A0A497NZG5 | 233-331 | None |
| A0A7C6ACL2 | 75-190 | None |
| A0A1J5CV66 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.