DPCstruct | MC50471
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 266 ± 47 aa |
| Standard deviation of domain lengths | 46.52 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 24.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A839VII0 | 190-444 | RERIMQDPPDIILTNYMMFELLMTRQNERDKAVIRHAQGLQFLVLDELHTYRGRQGADVAMLVRRVRERMNLNLVCIGTSATMATDG… |
| A0A497B7V6 | 20-306 | EILSRQEIRDRLPDILMTNYVQLELLLTRFEDKKLFPSEHRGVLRFLVLDELHTYIGKRGADVACLIRRLKQHTGTIGQLRCIGTSA… |
| A0A534HE12 | 281-629 | None |
| A0A1V4W178 | 192-413 | None |
| A0A563VP81 | 598-864 | None |
| A0A395M1Q5 | 214-393 | None |
| A0A3D6DYX3 | 184-460 | None |
| A0A7J4PWT2 | 195-484 | None |
| G7F7Q0 | 211-484 | None |
| A0A7T9R9H5 | 315-635 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.