DPCstruct | MC50470
Metacluster Properties and Pfam Annotations
| Number of structural domains | 418 |
|---|---|
| Mean domain length (aa) | 93 ± 19 aa |
| Standard deviation of domain lengths | 18.50 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 15.24 |
| Pfam Score | 47.28 |
| Assigned Pfam label(s) | PF01514- PF03780- PF16916- PF09580- PF01545 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497B4C7 | 79-178 | FRPKAVRVSQVAGGEASLALESIASRLQYNVSQLGDVVSVKPKVTVRGKGIRVEINLETNPEINVPAKIEEVCEVVRQTVEEQMGLK… |
| A0A7U1HVX1 | 2-73 | KAIADAQPGVARVNELLTMHFGPSDILVALSLDFDDAMPAGEVERTVSRIEKAIKSAHPDVTRIFIEAQSFE |
| G7TA50 | 19-102 | None |
| A0A1V9YP30 | 624-686 | None |
| A0A1G6BYZ6 | 210-293 | None |
| A0A284QTM0 | 825-921 | None |
| A0A843FC12 | 111-200 | None |
| A0A2R2WE54 | 17-130 | None |
| J5TEJ3 | 110-200 | None |
| A0A1M5RS22 | 1-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.