DPCstruct | MC5047
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 114 ± 19 aa |
| Standard deviation of domain lengths | 19.21 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 67.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 49.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y1R1F9 | 96-187 | APVRRSQKLSDKITVLQKLVSPYGKTDTASVLQEASIYIMLLQEQIQNLLRMFSSSYKNAAVLHTQECGSRQVLDLRSKGLCLVPVS… |
| A0A1D6J9A9 | 17-112 | SPKEKKDKIGERVAALQQLVSPFGKTDTASVLQEASGYIKFLHQQLEVLSSPYMRAPPAAGAAPEDPQRYSLRSRGLCLVPVDLTLQ… |
| A0A835PYP4 | 14-112 | None |
| A0A811RAU0 | 1-108 | None |
| A0A822Y1Q0 | 11-133 | None |
| A0A7J9FB12 | 1-97 | None |
| A0A446N463 | 54-189 | None |
| A0A022QJW2 | 171-294 | None |
| A0A6P8C743 | 140-267 | None |
| A0A2C9VWL9 | 286-424 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.