DPCstruct | MC50467
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1879 |
|---|---|
| Mean domain length (aa) | 163 ± 28 aa |
| Standard deviation of domain lengths | 27.65 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 11.70 |
| Pfam Score | 84.20 |
| Assigned Pfam label(s) | PF07833- CL0689- CL0041- PF10572- PF17217 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497AQX1 | 25-178 | AYEFITGTTTFTITTDVSGTMSTDDGRVRIEWPTASVTCTVVMTYTPLGRPGENLPTFLSFGGIAFDLQATDCNGDPVEAFLKPLTL… |
| A0A1G2XRD8 | 384-521 | SILVASGTNICNWGEAAEDTDIDMINSARITFDSSMAGTLTGNLLCDGRSDLPVNSFRVIGAWDFQNTASVSNVGIVVRYDDLLSAQ… |
| A0A1S3Q403 | 495-688 | None |
| A0A668RT01 | 51-219 | None |
| A0A668S4D2 | 90-256 | None |
| A0A673W016 | 609-814 | None |
| A0A7W1EM85 | 11-175 | None |
| A0A527V8Q7 | 508-622 | None |
| A0A7R9KIB6 | 265-451 | None |
| A0A0Q5V2Y5 | 28-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.