DPCstruct | MC5044
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 92 ± 13 aa |
| Standard deviation of domain lengths | 12.78 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 55.93 |
| Pfam Score | 94.59 |
| Assigned Pfam label(s) | CL0270- CL0484- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X1AYD2 | 2-92 | TKIKVDNPIVELDGDEMTRIIWDFIKQKLILPYLDVDLKYYDLGIQARDDTNDQITIDAAHAIQKYGVGVKCATITPDEARVEEFGL… |
| A0A1D6IFA0 | 4-95 | EKIKVSNPIIEMDGDEMTRVFWQSIKDKLIFPFLDLDIKYYDLGILHGEATDDKVTVEAAEATLKYNVAIKCATITPGETRRTYEAR… |
| A0A820MAK2 | 33-120 | None |
| A0A498N4I9 | 25-113 | None |
| A0A2P6S9D1 | 3-95 | None |
| E3K6X4 | 66-153 | None |
| A0A2G3BGZ7 | 510-598 | None |
| A0A2K1IJC7 | 1-75 | None |
| A0A2T4CR95 | 1-76 | None |
| A0A388Q4E0 | 1-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.