DPCstruct | MC50433
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 138 ± 25 aa |
| Standard deviation of domain lengths | 25.37 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0155 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y9Z9N4 | 10-125 | SLATAALALPRRLFPRDSGFALQNGQQAIAQNAQFATLTANLSCETGTDACVEQKFAQCVSGSYVLQSCGSGEICAALPLVNSAGTS… |
| A0A4Y7QG21 | 307-402 | ALKRRAAGADVQLANGKDAQALNAQFSTLSPSSACTAGSDACVNGEFAQCVGGSLVSVSCGATLQCFVLPLVNSRGTSVTCTTAADA… |
| A0A5C3L6Z0 | 2-159 | None |
| A0A317SYG1 | 219-341 | None |
| E3KX20 | 165-337 | None |
| K5UH63 | 13-169 | None |
| A0A397SKK1 | 1-125 | None |
| A0A146I921 | 12-191 | None |
| A0A3N4KW45 | 120-286 | None |
| A0A1Y2HSK5 | 1-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.