DPCstruct | MC50432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 138 ± 16 aa |
| Standard deviation of domain lengths | 15.68 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.11 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | CL0534- CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A383ZZL7 | 55-184 | ILVHLYLKNMKDFSSINSAYVTTFKHCLPARVCVETVLPEEVLFSIDCLIRQSDIKIDDGLFHPKEIPHVQNISHWAPASIGPYSQS… |
| A0A6G0LWF5 | 152-289 | LDMTVKAHVYLADPTDFVGFEEVWSEWFPDKTEAPSRTIVPNVELGAKGCRVEIALDLLLPEAKHLRQAISGGWTPKSHESAAMRAD… |
| A0A0M8N2N4 | 423-572 | None |
| A0A507BML7 | 536-695 | None |
| K5W5E3 | 2-93 | None |
| Q2HAB9 | 430-589 | None |
| A0A3M7MHI1 | 872-1035 | None |
| A0A7W1P5Y4 | 2-135 | None |
| C1MP73 | 794-924 | None |
| A0A0D0YFY2 | 112-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.