DPCstruct | MC50431
Metacluster Properties and Pfam Annotations
| Number of structural domains | 97 |
|---|---|
| Mean domain length (aa) | 62 ± 9 aa |
| Standard deviation of domain lengths | 9.27 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A371XGN9 | 10-70 | VTHEQPIDIRMLEMLACPLTKGPLTWDPARSELISRVAKLAYPVRDGIPVMLPSEARSVDD |
| A0A3D4P1F2 | 1-48 | MLACPLCKTEVRLTADGKGLKCLRCHRVYRIEDDIPVMLIDEASIEPE |
| A0A1S3G8M1 | 116-176 | None |
| A0A536RUL7 | 151-205 | None |
| A0A5N0UHF4 | 4-65 | None |
| F0W1Y1 | 40-106 | None |
| A0A7M4F5A2 | 45-109 | None |
| A0A7W0SB52 | 1-45 | None |
| A0A2V7KSS6 | 16-72 | None |
| A0A3A0BEF9 | 3-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.