DPCstruct | MC50424
Metacluster Properties and Pfam Annotations
| Number of structural domains | 178 |
|---|---|
| Mean domain length (aa) | 131 ± 19 aa |
| Standard deviation of domain lengths | 18.61 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 14.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04634 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A355TQA6 | 2-92 | SELENFVAKQIKTLVPHYEKVELEAVITSSSYSIEFFATVNGQKKQSFQMIDEGLFSEKAFNAASKAIADYVRALPSFNKDGLNKYA… |
| A0A2Z6AMU9 | 6-123 | ALADRTLNELGQQIIADPRYAGQDWQGIAVVVQVQPRQRLFGYVYRPDGSWTAGMPDMDATIDKALALSKAMQLDGKDAWKTCLIQI… |
| A0A419HCW3 | 159-303 | None |
| R5NE53 | 2-147 | None |
| A0A3N1KL87 | 149-276 | None |
| J4JGE8 | 51-184 | None |
| A0A542EG26 | 93-237 | None |
| A0A4R2J7I4 | 5-137 | None |
| A0A1E8B5R2 | 1-103 | None |
| A0A1Q6LHW9 | 6-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.