DPCstruct | MC5042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 76 ± 2 aa |
| Standard deviation of domain lengths | 2.40 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 88.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 32.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H1C9T5 | 14-87 | TPREVLLRHAVGEIDHEQMMAELEDWDYTFGGPPEGDPDADVYIRGSWDQIERAGDLLSDADYQRLLEVTAPVP |
| A0A7L5AL57 | 55-130 | VRPETPEELGFRRFLGQISSREMMDRLRTWPYTFGRIRDYDDYERGSWDEIRNLRRDGLLSDQEYAELKAITDPMP |
| A0A7U1CJY1 | 1-78 | None |
| M7NPN5 | 57-131 | None |
| F5XKJ8 | 69-140 | None |
| A0A101L9H1 | 65-139 | None |
| A0A2I9DP31 | 64-138 | None |
| A0A846WLY4 | 10-87 | None |
| A0A7T7MAB4 | 108-187 | None |
| A0A1X1R7P1 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.