DPCstruct | MC5041
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 188 ± 26 aa |
| Standard deviation of domain lengths | 26.08 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H0BUB4 | 36-168 | NIVQAKSTSSELNELKELLVQTSDTNDSVDVATDRKELLIKTIEQNSDTFFQHVLNSQETSALPRKLTDLGLVEQEKVFSGKLKLVI… |
| A0A3B1DH09 | 1-194 | MKQKKQLFSLLIIFFIIGNFVFFPDVSIGQGVKINIEANKKKCDKHTSELVNFHALYKAQNNLGLAQKSQKVDLVKKMSVAAKARSQ… |
| A0A358ELA5 | 37-243 | None |
| A0A2E9IV86 | 1-220 | None |
| A0A6C2UCB1 | 3-175 | None |
| B4D117 | 41-254 | None |
| A0A840UXN8 | 1-190 | None |
| A0A1G3EED5 | 164-348 | None |
| A0A5B9EAI4 | 22-175 | None |
| A0A7V2CXB1 | 30-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.