DPCstruct | MC50402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 49 ± 0 aa |
| Standard deviation of domain lengths | 0.35 |
| Length coefficient of variation | 0.01 |
| Mean AlphaFold2 pLDDT confidence score | 83.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 53.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y6U9A0 | 298-346 | FERTKTPVLGLVENMSFFACPHCQGETALFGHGGVAREAEALNVPFLGE |
| A0A7J6EI71 | 110-158 | FSKVQVPILGLIENMSWFKCPHCSEPSFIFGKHGTRKTADEMGLEFLGE |
| A0A388KMA0 | 171-219 | None |
| A0A1D6KXI6 | 73-120 | None |
| M7AYX7 | 1-49 | None |
| A0A7J7P4Y0 | 67-115 | None |
| A0A533XED4 | 611-659 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.