DPCstruct | MC50401
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 146 ± 32 aa |
| Standard deviation of domain lengths | 32.14 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 82.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.45 |
| Pfam Score | 97.23 |
| Assigned Pfam label(s) | PF01329- CL0662 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7P6D5 | 22-145 | SFMNHLIKFKEQKSMDKSAPAKHHKIPSILAKRFRTVFVEDSQKIELSGEKRNLLISYVLVLTLLADNFSTDITDIARDLKMSNVSL… |
| A0A7S2WKU6 | 361-520 | WVKSTKNVLNSVVGSPRSASNRYQIKTIQLLNFLIAFHNKCFKLFLPGTEEQIAKSAGIPSTICSRFLTMFAVPSEERGREGFSITK… |
| A0A1D1WA92 | 415-608 | None |
| A8JCV3 | 62-205 | None |
| A0A7S2V2D5 | 30-173 | None |
| A0A0F7RTW7 | 198-331 | None |
| A0A7J0G0K8 | 262-395 | None |
| A0A6V2QRL2 | 418-600 | None |
| A0A1A9XZB7 | 37-180 | None |
| M0ZR13 | 77-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.