DPCstruct | MC504
Metacluster Properties and Pfam Annotations
| Number of structural domains | 139 |
|---|---|
| Mean domain length (aa) | 210 ± 41 aa |
| Standard deviation of domain lengths | 41.27 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 86.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.22 |
| Pfam Score | 85.42 |
| Assigned Pfam label(s) | CL0016- PF17660- CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z3UH53 | 11-187 | QNRFNARVADGYRPTSVSASGSGNAAVFAAIFEKVPGKFTARHNLNADQFAAANAANARRGYMLTALNAYGTVNDPRYIAVWTQAPG… |
| A0A453M1F9 | 7-185 | YNIADSRLPHHIQNGYEDGVFISCIASSKNVWALIMDAGTGFSSQVFDLSQNFLQKDWIMEQWEKNFYITAIAGATNGSSLVVMSKG… |
| H8MX76 | 8-232 | None |
| A0A446Q1V2 | 260-404 | None |
| A0A6S7MYE5 | 306-466 | None |
| A0A7S4QYA6 | 234-480 | None |
| A0A1R3KAM9 | 3-132 | None |
| A0A7W0YN08 | 414-652 | None |
| A0A7C2TT02 | 642-882 | None |
| A0A1D6GC96 | 14-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.