DPCstruct | MC50396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 139 ± 16 aa |
| Standard deviation of domain lengths | 15.75 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 45.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L7NMK1 | 108-260 | KAMQWLADFAAGNPNSSAAFQTRVLPWLLECFGEDIAYDGMERNHRFLEEALELVQACGCTEAEALKLVSYVFGRPVGERSQEVGGV… |
| A0A6S6QMN9 | 5-123 | FSERCYDWAIRALGHAVASNPRERVLRVLEEAIELAQTEGVNQDVIDATVNRVYSRPVGHAPQESAQVLLTLSSYAACKGYHLEAMA… |
| A0A857JA31 | 162-289 | None |
| A0A2U8WLS7 | 93-231 | None |
| A0A2G6ZKY4 | 394-528 | None |
| A0A1M5NC57 | 2-119 | None |
| A0A024K8M5 | 269-422 | None |
| A0A383T9T6 | 181-318 | None |
| A0A1H4ZP95 | 3-132 | None |
| A0A7W5IFC2 | 67-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.