DPCstruct | MC50394
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 111 ± 17 aa |
| Standard deviation of domain lengths | 17.25 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0479 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K6L066 | 1-115 | MPHIKTYMRPSPDFSKIAWFLVTSANLSKAAWGALEKNGTQLMIRSYELGVLFLPSAFGLDNFKVKQKFFAGSQEPMATFPVPYDLP… |
| A0A2R7WJH7 | 53-160 | WYSNKRFRTRAPPHIKTYCRISKDHHQMYYFVLTSANMSKAAWGQQSKSGSLNILSYEAGILLVPQILISKDYFPLVEEDEVKPFSL… |
| D0MRF5 | 324-432 | None |
| A0A287IE94 | 1-113 | None |
| T1KMU2 | 101-198 | None |
| A0A7J8K1L7 | 78-205 | None |
| A0A1V9ZNZ3 | 912-1024 | None |
| A0A7S2XUG2 | 500-628 | None |
| A0A3P7D4V0 | 18-127 | None |
| A0A0R3QDB5 | 135-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.