DPCstruct | MC5039
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 329 ± 49 aa |
| Standard deviation of domain lengths | 49.02 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A523CUP8 | 2-201 | NEGKECLSNLDFVCAHTKFITALGECPESEEANFFASLTLIAGLLDTPELKTLLDRFGVESHGRDILSWTAGVPRDIDGKIVFPSDS… |
| A0A3B1D6T0 | 178-477 | LNQLITDGLEAVSNGWMLKARNYFKAAVDLAGNSTSNDTDTARFFYALTRVAAISADNFSDGNSSDMNNLGDILDRCGAPPSDTARV… |
| A0A7Y5WAG4 | 24-335 | None |
| A0A833KZM1 | 112-426 | None |
| A0A1W9HSA6 | 74-484 | None |
| A0A1M6YP00 | 31-360 | None |
| A0A7V1RDP3 | 14-450 | None |
| B8FNM6 | 183-449 | None |
| A0A7W0IQJ2 | 2-351 | None |
| A0A6N6PY21 | 10-339 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.