DPCstruct | MC50382
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 203 ± 36 aa |
| Standard deviation of domain lengths | 35.97 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18976 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A8RJG6 | 20-230 | HISAFSLVPRMMDNYAKAFHRNGITDHQQLVYVSKIEINRTYKHNDKSVLDGTKIKGQQKEGFNVHVHVVVSRMDVDRKIKLNPAIK… |
| A0A1M5JLD2 | 133-296 | ARKIMDNYALNFNRQDKGIKSGSDLVYFAKIEHFRKFKGTDKEVINGNKISGTYKKGLQSHVHIIVSRKDKTQKLKLSPTCNETLTK… |
| A0A212UHC5 | 100-321 | None |
| A0A4Y8KTH9 | 97-246 | None |
| A0A0U3GJ96 | 46-296 | None |
| A0A7G2T679 | 1-290 | None |
| R7KQM0 | 42-203 | None |
| A0A2K8ZA44 | 81-261 | None |
| A0A4R1R9S6 | 369-595 | None |
| A0A1H3P588 | 101-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.