DPCstruct | MC50379
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 248 ± 40 aa |
| Standard deviation of domain lengths | 39.78 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S2JLK4 | 1-207 | MSHHPSQQLYRYNDRPYCRYHYSLIKGTECAGCGQTVFEQNEALENWWHTECYMLRKYYHVQLVDLQLPYDYTSRQQLEQTQDSFEN… |
| A0A0F8DIY4 | 5-225 | YYEHEDQVYCHYHYSTQFAQRCNGCQTAILKQFVEIFRNGQNQHWHPECYMIHKFWNVRLASSDEPALVPGTGTQYDREVVREAEER… |
| F8P3R2 | 54-339 | None |
| A0A168GLY6 | 2-186 | None |
| A0A1Y1UZJ3 | 27-299 | None |
| A0A6A6S0V5 | 24-299 | None |
| A0A5E3XN33 | 498-788 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.