DPCstruct | MC50377
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 357 ± 67 aa |
| Standard deviation of domain lengths | 67.22 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 69.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X0RXW6 | 234-647 | ETFKTKEPQRKLYILKKSQTKQHGKKSLKNHARLVCRTENKKIKRLYYRRKSADTSDKEKWNVHIAKAEIRLEYLKGTFKEKITKSR… |
| A0A1X2G7P2 | 1-378 | MVRYLLRLLFRLHLAPNREQRYHAAKIMAANENAAKREIVRQSKSKQLKGRRNHVRNALRKQKWELEKKSKQNKLSNRQGDGYHKRI… |
| A0A197JD83 | 36-388 | None |
| S2JQV1 | 2-284 | None |
| A0A197JHX9 | 1-371 | None |
| A0A168KA92 | 373-736 | None |
| A0A168HZD0 | 431-746 | None |
| A0A0B7NGZ3 | 1-238 | None |
| A0A1X2GGQ0 | 439-769 | None |
| A0A1X2GEW2 | 15-479 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.