DPCstruct | MC5036
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 91 ± 14 aa |
| Standard deviation of domain lengths | 14.19 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.74 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 48.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13763 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A399UG55 | 1-86 | MRDFKGMKRQRGRNRKPGGGNNANATNPNRSWDSQGPENIKVRGNAQTVYERYMQLARDAAAAGDRVLAENYTQHAEHYFRVLRAL |
| A0A2D9RJ51 | 1-65 | MKRQRGRGRKSNNSGNRSYESNGPDVKIRGNANQIYEKYLQYARDAQTSGDRVAAEAFFQHAEHY |
| A0A3D2FW57 | 1-100 | None |
| A0A7V9MX78 | 58-153 | None |
| V4QE12 | 1-78 | None |
| H6SK94 | 101-184 | None |
| A0A1K2E512 | 1-96 | None |
| A0A7H4KEW6 | 1-80 | None |
| W6K5W8 | 5-91 | None |
| A0A6P1YJ98 | 1-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.