DPCstruct | MC50358
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 143 ± 22 aa |
| Standard deviation of domain lengths | 22.16 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4LKE1 | 1-141 | MRFSSILSLGGLAVQSVSGLPGTLEKRVNVDQWIQQELPIARAQLLCNIGPNGCNSAGVASGLVIASPSKSDPDYFFHWTRDAGLVF… |
| A0A060SPL9 | 23-132 | VDAYVASESPVAKQGVLNNIGPNGSKSHGAKAGIVVASPNTENPNYLYTWTRDSSLVFKLLIDQFTSGEDTSLRTLIDQFTSAEAIL… |
| A0A178F7H3 | 2-145 | None |
| Q4WPR0 | 95-238 | None |
| A0A5N5QWF2 | 282-431 | None |
| A0A5N5Q9H7 | 1-145 | None |
| G9ET42 | 12-124 | None |
| A0A2C5YCF2 | 1-187 | None |
| A0A395ILG9 | 2-151 | None |
| A0A146IDJ1 | 1-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.