DPCstruct | MC5035
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 170 ± 33 aa |
| Standard deviation of domain lengths | 32.63 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 23.86 |
| Pfam Score | 98.75 |
| Assigned Pfam label(s) | PF13864- CL0334 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q1JSW2 | 40-207 | VLSKKKPRWKAPTPAADDRPIMGIKSIRDHVTANAIDNILSRPKKNSGRLFDWMKKPNYGAVPEYLKEIKNRLQLEYAYVESLRKDN… |
| A0A812VAT2 | 10-144 | FIVANAVEVILAAPKKLPEGSRDYLKKEDYGKIPKYLSHIKKDIDAEYEYIRQLQQQREQEEADRMRPLLEDERHHLIEGLKTKWES… |
| A0A835CTE8 | 247-399 | None |
| A0A1D2N1L2 | 600-747 | None |
| A0A7S1FJW5 | 61-240 | None |
| A0A158QFF0 | 493-679 | None |
| F0WSZ9 | 89-263 | None |
| A0A1J1IWA4 | 58-253 | None |
| G3ICY1 | 19-160 | None |
| H0YSD7 | 214-416 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.