DPCstruct | MC50349
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 91 ± 14 aa |
| Standard deviation of domain lengths | 13.80 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 21.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02406 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D5WPK5 | 10-97 | LNGCGITMNDSEQARVIAEVMRTKPGVRVSEEPALINIDADRNLVFNMAELSEAMGSDFDVYQFQIEVTAYYGRMVVQDDQVILFANQ |
| C3NLL9 | 17-112 | TDLSKLSQNIVGPVLTKDEFSYGVVEAIADDNPNTFKGVIDRGSYIRIVGERELVLNKSTLEEVLGREVRFPGEVEVRMSAFAGKII… |
| A0A550D3J2 | 3-81 | None |
| A0A3M1WK28 | 1-100 | None |
| D2K2C0 | 2-83 | None |
| D2K2D0 | 43-144 | None |
| A0A662RU38 | 2-96 | None |
| A0A292YWN4 | 6-68 | None |
| A5EHS5 | 13-110 | None |
| U2FNK1 | 2-60 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.