DPCstruct | MC50348
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 84 ± 15 aa |
| Standard deviation of domain lengths | 14.96 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 95.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 46.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02570 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M4M3C0 | 15-89 | IFAVGNAPTALFTLKRLIEEGKTKPDLIIGVPVGFVGAAESKESIRDLGIPYIITRGRKGGSTVAAAIINALLYM |
| A0A6N7YL10 | 117-201 | AALELWRDRLAGSVVAIGNAPTALFRLLEMLDEGAGVPAAIIGVPVGFVGAAESKVELAKRAPAPYLVVHGRRGGSAMAVAAVNA |
| A0A378AI74 | 240-331 | None |
| A0A2S4MEN0 | 552-636 | None |
| A0A2E7BBP6 | 6-65 | None |
| A0A1I3L534 | 435-531 | None |
| A0A7C1YWF7 | 1-73 | None |
| A0A139PDA8 | 1-59 | None |
| A0A1I3RFH1 | 409-514 | None |
| A0A1V5HVK1 | 144-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.