DPCstruct | MC50343
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 126 ± 20 aa |
| Standard deviation of domain lengths | 20.28 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 73.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834IVL4 | 2-125 | SLASVRHPTDIHSSHSSLTTLSHSLEDIASWSYGHHGEAVLTIEELRDQLKCCFTCGVSWADSHISLDCSECGGYAMERPCPKCDGA… |
| A0A5E4NHE5 | 2-106 | SSTSIQSMNNQNLRSINDQRFDNIDLVSDIEQAVTLEELKGVFKYCFRCGVNWEQDHVSLDCLECGGYSLERPCPICVGHCRNTWKR… |
| Q173L3 | 22-181 | None |
| A0A6I9VW53 | 58-178 | None |
| A0A182XZR7 | 19-131 | None |
| B7PBN7 | 8-159 | None |
| A0A1J1IPH2 | 696-814 | None |
| A0A6A4V9W0 | 218-327 | None |
| A0A7J7ABQ2 | 59-201 | None |
| Q9VPW8 | 79-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.