DPCstruct | MC50340
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 118 ± 12 aa |
| Standard deviation of domain lengths | 12.16 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834IMV8 | 32-154 | NIPGVRKIVMSELTQKIIECVVGEDVTSENPWKYVRKELVQDNLELHEESSEFLPIRREILAYPRPELLVGYIADETKDTEDEFFYI… |
| A0A0D2LZF9 | 24-150 | SPAAGRLGLEPLPYVVGEDGAKQPVPGALSIFLRSGTAAAMCLDSLAAAQPGAPPFLRIPKEKLLADIQLQGAISDFHPIKDAIRAA… |
| A0A7S2MP87 | 77-169 | None |
| A0A834XW91 | 21-157 | None |
| A0A834U6V7 | 241-358 | None |
| A0A821B8D3 | 66-199 | None |
| R1CUV2 | 7-146 | None |
| A0A498NYG8 | 1-118 | None |
| A0A3Q3VLL7 | 12-117 | None |
| X6NZ37 | 2-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.