DPCstruct | MC5034
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 186 ± 20 aa |
| Standard deviation of domain lengths | 19.55 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13548 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8JPY3 | 2-184 | ADLLSAVLGLSFASGLNAYATVLGLGVMHRLGVFHLPPRLEVIATTPVITAAAVLYMVEFVADKIPFIDTLWDGIHTVIRPAAGALL… |
| A0A2V6FK40 | 22-219 | RLNLLSVALGLACLAGLNLYLTVFATGLTIHFHWIVLAPQYQSLSILGDPIVITISGVLFLLEFFADKIPWIDSIWDAVHTIIRPIG… |
| A0A1Z4RKQ6 | 2-187 | None |
| A0A3M1VT78 | 409-601 | None |
| A0A0C2DCW4 | 2-190 | None |
| A0A2P4RMS8 | 104-300 | None |
| K0S6T9 | 8-255 | None |
| A0A2V8MU79 | 4-172 | None |
| A0A2V6T5C1 | 1-175 | None |
| A0A6P2A4I9 | 11-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.