DPCstruct | MC50333
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 61 ± 5 aa |
| Standard deviation of domain lengths | 5.24 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 74.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0254 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J5V9L2 | 1-59 | MTRSGQWSIIFLINNGGYTIEVEIHDGPYNVIKNWNYTGLIDTIHNGEVKCWTTKVRCE |
| M8B9R4 | 314-383 | MLRCGQNSIIFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTTKVTCEEELTAAIETAT |
| A0A314Z1U0 | 1-59 | None |
| D8R132 | 655-710 | None |
| A0A817BAZ5 | 1-59 | None |
| A0A453E4W4 | 1-57 | None |
| A0A2K1Z4B2 | 132-197 | None |
| A0A1U8KPL3 | 156-208 | None |
| A0A0E0L3M8 | 99-157 | None |
| D8S198 | 561-628 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.