DPCstruct | MC50331
Metacluster Properties and Pfam Annotations
| Number of structural domains | 317 |
|---|---|
| Mean domain length (aa) | 107 ± 21 aa |
| Standard deviation of domain lengths | 21.01 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 70.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.23 |
| Pfam Score | 92.18 |
| Assigned Pfam label(s) | PF03004- CL0125- PF03017- PF13968 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J5UNZ8 | 16-120 | LRNKLFKPNRDAKVVINTQGKECKMAFGEKANLVASGTIVEIDVPNQLVHNVPLGEGNIRVAVNCALKGDSPLPIPVKRVLETVGDA… |
| A0A843XRM4 | 2-80 | VYLKSFKKSLVNVALATIENKDPLKKVGDCDLGCEYWEVAINVALVYSEPLPRPYGQFKTIGDAIGETIAWPFTLVRMC |
| A0A445I3Z6 | 307-388 | None |
| A0A0B2QDD0 | 3-88 | None |
| A0A4U6SWD7 | 235-357 | None |
| A0A0B2PTN9 | 15-120 | None |
| A0A0B2PE10 | 28-104 | None |
| A0A0B2NUM0 | 2-83 | None |
| A0A445HN31 | 115-223 | None |
| A0A5N6PCD6 | 596-700 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.