DPCstruct | MC50328
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 99 ± 7 aa |
| Standard deviation of domain lengths | 7.24 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0237 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847D958 | 4-100 | KAALYHLKKYAFTHFDPDVVKVFLSIAKSKGLSTEDDVGIPLERLKEGMKLRRSLYTQSGRFLLPYDTVLTNDIIMKLKRFAKTNPI… |
| A0A433FEV8 | 77-174 | EALLYISKYARRLYDPALVEDFVKACSTFLSDVTLGDPSVKVLSTRDLEAGMVLARNLNADNGMLLLNAGKVLNLPLVEKLIAFEAM… |
| A0A7X9FLG2 | 40-136 | None |
| A0A809QID4 | 100-196 | None |
| A0A318CT20 | 415-513 | None |
| A0A455XE65 | 175-266 | None |
| A0A7C5WIN1 | 84-193 | None |
| A0A0S8A9E5 | 291-388 | None |
| A0A162VRA1 | 339-443 | None |
| A0A348MU92 | 144-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.