DPCstruct | MC50327
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 210 ± 35 aa |
| Standard deviation of domain lengths | 35.08 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 73.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B5LHQ0 | 8-179 | VQREGVYRWFSTLTSAQRAEFLCGLLDLCIPIELRFLGSCLEDLARKDYHSLRDAEIKANNPADLSGLTNVTDEVVRSKLLVSLALL… |
| H2ZVE1 | 9-155 | EAVYKWFKLGLPSAQRVDFLYGLLDLCHPLELRFLGACLEDLARKDFHSLREAEVRANSLGDMSQLSDLTQPEVRCKLIVYLALLAS… |
| A0A1D2NCS2 | 7-212 | None |
| A0A817CRJ4 | 5-231 | None |
| U5EQ25 | 1-196 | None |
| A0A6P4ZE39 | 2-172 | None |
| S4RPB5 | 11-175 | None |
| A0A482WVT2 | 44-280 | None |
| A0A4W3GQ62 | 16-211 | None |
| A0A6P8R9U2 | 5-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.