DPCstruct | MC50326
Metacluster Properties and Pfam Annotations
| Number of structural domains | 85 |
|---|---|
| Mean domain length (aa) | 145 ± 30 aa |
| Standard deviation of domain lengths | 29.91 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B5LGQ9 | 15-153 | EIYCSGPILHHMQEAKLFNDDKHFVDMKLKSPPGEVLAAFQTLLNEWPNSSIPTKELQEFLEANFDKPGTEFETWTLTDWQEKPRFL… |
| A0A7R8WRI6 | 2-136 | QIYCQGKLLDMVQKAKIFEDGKHFVDMKLKFLPTVVLDNFEQFLIDYPNPTPVKIKEFVFDNFDPPGSELIDVVPADFSESPKFLER… |
| A0A482VSF9 | 593-769 | None |
| A0A7R9D1N6 | 267-398 | None |
| A0A3P7DSN0 | 37-202 | None |
| A0A0J0XJB9 | 49-247 | None |
| A0A653C7N7 | 1-125 | None |
| A0A5J5S2I5 | 23-163 | None |
| A0A3Q0IZ97 | 74-222 | None |
| E9HWC9 | 13-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.