DPCstruct | MC50324
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 229 ± 37 aa |
| Standard deviation of domain lengths | 37.40 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 69.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 48.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10148 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B5L4B8 | 26-222 | SCSKSTPSSRLQSGVNLQVCFVNDSSSDKDSDAEDSRTETSLDTPLSPMSKQSSSLSDRDTAEEDSDPLDDCSGFWRVQRRLQEEAR… |
| T1K2G3 | 513-636 | LNTARPNDMSTFHRYHNLIIAEARFALSQAKEMAQMQMETERSKVKPNPVAELIQLPVDRHFNKEVLKEMSVPKLQIIVNDLLSQIE… |
| A0A1D2MWM2 | 2-186 | None |
| A0A5N5TH29 | 96-290 | None |
| A0A653BNW4 | 5-180 | None |
| A0A6A4V2T3 | 170-419 | None |
| A0A2J7Q4A5 | 45-306 | None |
| A0A670I2D3 | 223-505 | None |
| A0A803Y955 | 1-239 | None |
| A0A6P3RQK5 | 1-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.