DPCstruct | MC50323
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 267 ± 52 aa |
| Standard deviation of domain lengths | 51.58 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 68.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.53 |
| Pfam Score | 92.58 |
| Assigned Pfam label(s) | CL0123- PF08597- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B5L3Q5 | 1-272 | MLSSKKSDAGSSSSSSSSSVGAAGGERPLGADVQSGPSASASGPLDPKKKERSSPSGEPRGPPFPHQSGPAGADADSAEVRRTSRRK… |
| A0A287J1R0 | 7-232 | PSTLLPLASLPPNPNPNPTPPPVPALHISALPSPSKRKRTGFRRKVPSAASPAPHPPVPPSAADDIIVINREPTAEAVTALTAGFPA… |
| A0A158PBJ7 | 10-246 | None |
| A0A163JGF2 | 59-431 | None |
| A0A167D0C5 | 352-684 | None |
| A0A433Q480 | 84-405 | None |
| A0A182E2Z1 | 173-394 | None |
| A0A397I537 | 56-362 | None |
| A0A7R8VGP6 | 43-294 | None |
| A0A7I0Z6S2 | 323-494 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.