DPCstruct | MC50320
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 218 ± 23 aa |
| Standard deviation of domain lengths | 23.44 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 15.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19578 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D8X9X7 | 14-250 | GVNKTGKYVKYALGEIFLVVIGILIALQINNWNEFNKEQALLTASLNSLILNLNEDIENLNKQIEYNRDVQEAIEFSFRIISLPDYE… |
| A0A124F4U4 | 3-179 | EEVAVFLANLKNDLKSDIKSIDNEKEAYQKSNIEYEKILALTTLQLDSIYKSKNKVNFPIYSHGPKMNIANYEGFKSSGKIGYIEDE… |
| A0A1G9VQT5 | 8-217 | None |
| A0A5C7BAY4 | 9-176 | None |
| A0A7G9SF38 | 1-226 | None |
| A0A2G5LDW1 | 1-181 | None |
| A0A2W4XCR9 | 11-255 | None |
| A0A285R0U9 | 7-212 | None |
| A0A7Y4XMU8 | 173-387 | None |
| A0A1G0IF45 | 11-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.