DPCstruct | MC5032
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 131 ± 12 aa |
| Standard deviation of domain lengths | 11.92 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F2R896 | 154-299 | IGDIALDVAEHLPGQWTARVENYSLRVWQEDLAGGLWSTGPIAQTLAANRVRQAAILKRDDGTELAVVKDPHLDTYHVGALRPGHVP… |
| A0A5P8K3L1 | 114-251 | RIATFGSDLESLAHGLCHRLPGEWACHVTDFADPDSQLDFFDDLWDNASLASAWMQFRVPRAAILTGPDRLELVMIDRPLHRDQVLV… |
| A0A5C8Q1M5 | 81-206 | None |
| A0A1H8A7B6 | 20-153 | None |
| A0A3N1L763 | 2-143 | None |
| A0A3N1LHZ8 | 1-119 | None |
| A0A4R7HVE9 | 3-112 | None |
| D9X364 | 5-109 | None |
| A0A401VXT5 | 6-138 | None |
| A0A3N1LI21 | 126-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.