DPCstruct | MC50318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 380 ± 44 aa |
| Standard deviation of domain lengths | 43.83 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 20.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F4CX28 | 63-425 | AKFKLNIISATPTTPGSFPVITFSVTDPTNGDRPYDIKTDAPFTAGGASTLNVRLGWSASGIADIGNDGSGQNFGQPVSINLLNNAA… |
| Q8EG34 | 271-661 | KNWSRIPTMEVCSSCHVDIDFAAGKGHSQQLDNSNCIACHNSDWTAELHTAKTTATKNLINQYGIETTSTINTETKAATISVQVVDA… |
| A0A1J5Q4R8 | 173-539 | None |
| A0A0M4D7J7 | 357-778 | None |
| A0A7C4DL30 | 3-322 | None |
| A0A6L9KRN1 | 457-879 | None |
| A0A424XYE6 | 410-820 | None |
| A0A524P2D3 | 291-689 | None |
| A0A1F3YD90 | 2-352 | None |
| A0A7Y2YLW6 | 1-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.