DPCstruct | MC50312
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 138 ± 22 aa |
| Standard deviation of domain lengths | 21.74 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A561TX40 | 192-326 | DSFGPEWAWCRSVRPAGEPRVHEITGPEDWCELVERYPMEVTLSRRHDWFRVTGWTGRWMTPDWEAVAADHDAVHLTLTGYLTTAGR… |
| A0A4R5B600 | 8-132 | ALWTSSFLPDGAPAWSWGEPKVARGSKRDCYELHFRADEVEAYTIDSLPDYLELVRGFPACTSDGKINVHWSRVAEVFDAVRLRARG… |
| A0A1R4HWT2 | 2-102 | None |
| A0A6C1BXK7 | 243-381 | None |
| A0A848Q708 | 122-266 | None |
| A0A6C0HF36 | 1-140 | None |
| A0A6I1P8D8 | 100-247 | None |
| A0A0S9PZ28 | 9-179 | None |
| R7HHT2 | 1-147 | None |
| A0A2N5IAS3 | 6-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.