DPCstruct | MC50306
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 239 ± 40 aa |
| Standard deviation of domain lengths | 40.28 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 39.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5K5B9 | 162-405 | CIFSFLLSIYLTKWVLSKDEGPPEMVQISDAVRDGAEGFFRAQYSTISKMALLLAVVILCIYLLRSTTPQQESSGLGRSTSACITVA… |
| A0A446K145 | 2-208 | AFLLGAVTSVVSGFLGMRIATFANARTTLEARRGIGAAFATAFRSGAVMGFLLSSLGLLVLYVAIKLFGLYYHDDWEGLYESITGYG… |
| A0A0V0QJD7 | 38-341 | None |
| A0A7J6L8Q7 | 111-382 | None |
| A0A3C1ERM7 | 15-281 | None |
| A0A7J9E350 | 2-261 | None |
| A0A662MHL3 | 95-358 | None |
| A0A1S3VWC9 | 2-214 | None |
| R7QL36 | 80-342 | None |
| A0A7R9AJM5 | 2-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.