DPCstruct | MC5030
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 213 ± 38 aa |
| Standard deviation of domain lengths | 38.03 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U0ZJV9 | 2-170 | DIFRVTIIATNETIAYYELSEEKYKKAGDGWESYYDLIDKFEDRKLLDSLQKSFKRIFQADLNKSELFITDFVYGRHCGNAGVDPEG… |
| A0A365XUU1 | 42-255 | VSRLTKRLDTLLKHYMPSRSQVVKNIHRPLDVGFYHIRYQVSYWPMNYFINMLVRNDSVFMLTAYSCEDLWRKASDYKDAPEPLRLY… |
| A1ZK37 | 25-247 | None |
| A0A1Q3GVC6 | 25-211 | None |
| A0A6S6T1L9 | 39-303 | None |
| A0A5B7TQ53 | 1-147 | None |
| A0A848IT52 | 198-408 | None |
| A0A1T5ECB1 | 84-287 | None |
| I4AL95 | 92-318 | None |
| A0A5M6D745 | 2-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.