DPCstruct | MC50293
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 227 ± 35 aa |
| Standard deviation of domain lengths | 34.54 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 22.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D1NXB4 | 1-278 | MEIPLNNKDISNFLICFFSYKLKESNLQLTERKLNSGLINDNTHTIDNNVNMSTFGQLKTKNEIKNCIEMALDRKGYYYCLISIKGH… |
| A0A379FJS1 | 475-657 | NEYYAIIAFKTHAIALAYKRYSNNHYKFTLFDSNSELTEFSNIESIKDALIKTMGSYTLNKADGKEYFIIDEYKRNPTTKYRSLWDQ… |
| A0A4P2SM79 | 141-407 | None |
| C4K3P9 | 197-398 | None |
| A0A2D3T3R8 | 216-439 | None |
| A0A379FU48 | 224-481 | None |
| C0AZ64 | 19-203 | None |
| A0A2D3TEJ1 | 1-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.