DPCstruct | MC50281
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 138 ± 17 aa |
| Standard deviation of domain lengths | 17.39 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 65.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.77 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 29.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C5GJS1 | 1-117 | MADIEKVKGVGSVLAFHFRERGIDSARALLDAGHDALLDVHGVGAARARRLILAAEDALAMPEPEVGSPAEEAVPAAPEPAAAPVKA… |
| A0A4S3MCK2 | 56-197 | STTDVKGIGPAIAAQLADLGVHTAADLAAADPAVLTKVSGIGPARAVMLIREAQDLVSVLPGEPVAEVVAQPEPEPVPEAVEEVAEV… |
| A0A5C4SBI9 | 1-123 | None |
| A0A7Y2CPE7 | 1-119 | None |
| A0A3N2R0R4 | 1-161 | None |
| A0A432QL06 | 20-137 | None |
| A0A5P3A805 | 1-158 | None |
| A3W2N8 | 1-136 | None |
| A0A1M6GHP2 | 3-152 | None |
| A0A7G2TJF5 | 52-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.