DPCstruct | MC5028
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 137 ± 13 aa |
| Standard deviation of domain lengths | 12.97 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A238Y1M5 | 138-263 | ELMTLKEFCTKTGIPIETALKNLRNNGIKVESADETLKEIAIKNNTSPAMLYKIINKGKYQAQNTFTPGMGFGRKTVKEVCISYGLT… |
| A0A6G7VFI4 | 3-127 | VLAQRAGFILDEAVATWRAAGIELDDANTTLENIARANRMTPAALFALIPNGPPAARDPAAIEAQLAGSGLGAKTLADFAEHQGLIP… |
| A0A6I6EFS8 | 22-136 | None |
| A0A660V056 | 78-218 | None |
| A0A660UTY4 | 386-516 | None |
| A0A6V8M165 | 143-309 | None |
| A0A3M1QAR7 | 142-276 | None |
| A0A1V5MN85 | 104-245 | None |
| A0A7K3NKW9 | 140-292 | None |
| A0A2M7KMN8 | 7-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.