DPCstruct | MC50276
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 115 ± 16 aa |
| Standard deviation of domain lengths | 15.52 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F2QXR7 | 35-147 | EDMALIAPSEKMSEYIIDFGHPMLEGAKTFEDQTKAILFAVLAWNAALLPDVKRVAYVAEMKKMFSFPDTIDEILAFLIARKKAFFS… |
| A0A1V4AXP9 | 5-118 | KEKISEMVAHFSREYLALGEDVEHKQQLLNSAISAWNIASLGEKNREGAIKKYLEGWKRLNPTHEKDMLKGMEEDLRLLIKRKLELY… |
| A0A2Z4FK56 | 3-119 | None |
| I5D2E0 | 39-160 | None |
| A0A7V4HGC5 | 31-151 | None |
| A0A0F5JTK8 | 3-100 | None |
| A0A251WKH0 | 42-161 | None |
| A0A7Y6XFY3 | 541-671 | None |
| A0A657AK41 | 8-126 | None |
| A0A3C1FYX4 | 6-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.