DPCstruct | MC50275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 151 |
|---|---|
| Mean domain length (aa) | 371 ± 72 aa |
| Standard deviation of domain lengths | 72.10 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.43 |
| Pfam Score | 71.66 |
| Assigned Pfam label(s) | CL0126- PF10415- PF08328- CL0105- PF10397 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M8FY30 | 7-392 | DDVLLDRELFPFDILATRAHVKGLASIRLIEEADASRINTALVELDRLFASGAFVLDERYEDGHSAIESFLVDKLGEAGKRVHLGRS… |
| A0A420IRM5 | 85-536 | AEYRIETDAFGEVKVRADRYWGAQTERSLGNFKINQPQDRMPSPIIKAFGILKGAAATVNMRYGLDSTIGKAIQEAAKEVADLKLID… |
| A0A1Q9C215 | 379-664 | None |
| A0A1T3P777 | 238-685 | None |
| A0A258L726 | 2-304 | None |
| A0A812P1I4 | 382-802 | None |
| K2DPL1 | 27-466 | None |
| A0A0K2RUM3 | 3-278 | None |
| A0A2E1V596 | 3-277 | None |
| A0A1I8FKZ5 | 15-424 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.