DPCstruct | MC50263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 147 ± 13 aa |
| Standard deviation of domain lengths | 13.22 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 37.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M7DMT6 | 10-139 | ADPNTSSRAVFTEVLINNPIPDNACEDWKNQVKSLKELYQLLANHPGMSRNNEQLFAQPAHENNTVYFMWDFTMAYMVDPTLPKDKK… |
| A0A7U2FFL8 | 22-165 | PDTKKTTRSDFTNFFIRFQPAPDAHPAYQHLFLIHQRLAKLLIEHPAMVQNVQQTFATPANSKNKVYFMWDFVLRTFQHLAAQVDPH… |
| A0A6P8B9L9 | 17-167 | None |
| A0A4U0XJZ5 | 2-155 | None |
| A0A6A5W9W4 | 1-143 | None |
| A0A4U0XSW0 | 1-149 | None |
| A0A139HDS0 | 89-235 | None |
| A0A6J3MFT2 | 6-167 | None |
| A0A4V4JDW2 | 1-118 | None |
| A0A2G5HSV3 | 53-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.