DPCstruct | MC50257
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 134 ± 18 aa |
| Standard deviation of domain lengths | 18.18 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.23 |
| Pfam Score | 98.96 |
| Assigned Pfam label(s) | CL0020- CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4CG33 | 448-567 | PALEKKLQLQGILDQRGSGELYEHEKDLVWKMRHEVQEHFPEALAHLLLVTKWNKHEDVAQMLYLLCSWPELPVLNALELLDFSFPD… |
| X6P729 | 2-127 | EEKQLIWMARDLLWHDPSALPAFLRSVNWTSRLHIAEAHKYLKTWTQPLFFSDALEFLDYRYADITVREMAIKWLDEMHDSELQQYL… |
| A0A0F7ZL36 | 663-795 | None |
| J9B4D5 | 522-664 | None |
| A0A0N0PE29 | 109-233 | None |
| A0A4Y2AAK0 | 199-326 | None |
| T1GFL2 | 219-345 | None |
| A0A6A4GU72 | 120-256 | None |
| B0EVF1 | 231-353 | None |
| F4PZL5 | 510-683 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.